PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g64140.1.p
Common NameBRADI_1g64140, LOC100820870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 328aa    MW: 36292.2 Da    PI: 4.5451
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g64140.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.8e-182269148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Bradi1g64140.1.p 22 RGPWTVEEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 69
                      89********************************************97 PP

2Myb_DNA-binding51.32.8e-1675118146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Bradi1g64140.1.p  75 RGSITPQEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 118
                       7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0761769IPR017930Myb domain
SuperFamilySSF466898.59E-3120116IPR009057Homeodomain-like
SMARTSM007172.1E-152171IPR001005SANT/Myb domain
PfamPF002491.4E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-222376IPR009057Homeodomain-like
CDDcd001671.57E-112469No hitNo description
PROSITE profilePS5129423.61770124IPR017930Myb domain
SMARTSM007178.1E-1574122IPR001005SANT/Myb domain
PfamPF002492.4E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2377123IPR009057Homeodomain-like
CDDcd001675.07E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDMAHERDSS SEEEVMAGDL RRGPWTVEED ILLVNYIAAH GEGRWNSLAR SAGLKRTGKS  60
CRLRWLNYLR PDLRRGSITP QEQLLILELH SRWGNRWSKI AQHLPGRTDN EIKNYWRTRV  120
QKHAKQLKCD VNSQQFKDVM RYLWMPRLVE RIQAAEAAQP ADADTPVSWQ ADGIYDESPE  180
ELPLAVDACC WPADHQYGAA ASGAGHQLLN SSAVPEPSST TTGSSSSPST DDSGAGAQPS  240
CWPATVDEWF TASSAAAVAM RDTDQQLIIQ QQAPCQQAGE AWTSEPVLPG NAGFPELGVA  300
DFEMGSFDVD SIWSGMDDLW YTQPQFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251312218126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519090.0JF951909.1 Triticum aestivum clone TaMYB26 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561685.10.0PREDICTED: myb-related protein P-like
TrEMBLI1H6400.0I1H640_BRADI; Uncharacterized protein
STRINGBRADI1G64140.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-83myb domain protein 112